GET /api/protein/UniProt/A0A7H0I826/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7H0I826",
"id": "A0A7H0I826_9ACTN",
"source_organism": {
"taxId": "2768066",
"scientificName": "Streptomyces roseirectus",
"fullName": "Streptomyces roseirectus"
},
"name": "Pectate lyase",
"description": [
"Catalyzes the depolymerization of both polygalacturonate and pectins of methyl esterification degree from 22 to 89%, with an endo mode of action. In contrast to the majority of pectate lyases, displays high activity on highly methylated pectins"
],
"length": 262,
"sequence": "MTSLARAAGGGLAALSLSIGMIMTSGAASPAQAATWPSANGSQGVSSTIPVSGTKDYGMKRLYGTGALGTDNQGEDQGPILELAAGAVLKNVILGAPAADGIHCKGSCTLQNVWWEDVGEDAATFRGSSSSNVYTVSGGGARAASDKVFQFNGAGTLNVSNFAVQNFGTFVRSCGNCSTQYKRTINLNTIEATYSGGKLVGINTNYGDSATLRRVTIVGDSGRKIVPCQKYIGNNSGKEPSTNGSGPDGTYCKYATSDVTYR",
"proteome": "UP000516052",
"gene": "IAG44_05420",
"go_terms": [
{
"identifier": "GO:0030570",
"name": "pectate lyase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "fd4da57c2ca863f1060db7afc994428a23d5ba43",
"counters": {
"domain_architectures": 6618,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6618
}
}
}