GET /api/protein/UniProt/A0A7H0EXQ5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7H0EXQ5",
        "id": "A0A7H0EXQ5_9CYAN",
        "source_organism": {
            "taxId": "2666332",
            "scientificName": "Cylindrospermopsis curvispora GIHE-G1",
            "fullName": "Cylindrospermopsis curvispora GIHE-G1"
        },
        "name": "NAD(P)H-quinone oxidoreductase subunit I",
        "description": [
            "NDH-1 shuttles electrons from an unknown electron donor, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory and/or the photosynthetic chain. The immediate electron acceptor for the enzyme in this species is believed to be plastoquinone. Couples the redox reaction to proton translocation, and thus conserves the redox energy in a proton gradient"
        ],
        "length": 194,
        "sequence": "MLKFLKQVGDYAKEAVQSARYIGQGLAVTFDHMQRRPVTVQYPYEKLIPGERFRGRIHYEFDKCIACEVCVRVCPINLPVVDWEMDKATKKKKLKHYSIDFGVCIFCGNCVEYCPTNCLSMTEEYELATYDRHELNYDNVALGRLPYKVTNDPMVTPLRELVYLPKGVTEPHGVPADAPRAGSFPQDLVESGRE",
        "proteome": "UP000516013",
        "gene": "ndhI",
        "go_terms": [
            {
                "identifier": "GO:0008137",
                "name": "NADH dehydrogenase (ubiquinone) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016651",
                "name": "oxidoreductase activity, acting on NAD(P)H",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051539",
                "name": "4 iron, 4 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6c07d9494256355cee46d63af45f6573fe21c2b0",
        "counters": {
            "domain_architectures": 45829,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 3,
                "hamap": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 45829
        }
    }
}