HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7G9Z2B4",
"id": "A0A7G9Z2B4_9EURY",
"source_organism": {
"taxId": "2759913",
"scientificName": "Candidatus Methanophaga sp. ANME-1 ERB7",
"fullName": "Candidatus Methanophaga sp. ANME-1 ERB7"
},
"name": "L-aspartate dehydrogenase",
"description": [
"Specifically catalyzes the NAD or NADP-dependent dehydrogenation of L-aspartate to iminoaspartate"
],
"length": 283,
"sequence": "MVKIRVGVVGCGSIGSEICKAIDSDEASGLDLGMELKFLIDTNPANIDRLCKSLTKTPDILKSDNTGLDRVLDTVDLVIECASQAAVREFIIPALKKGKEVMILSVGALLCESGLFEEIEKIAKEKGCKVHIPSGAVAGIDGLKSGAIGGIHKVELTTKKPPLGFEGNRYVKGQGIDLLSIKKAETLFMGHAKEAVKYFPENVNVAASLSIAGIGAEATKVKIVADPSTKKNVHEIVVKGKFGKFFVCIENEPSITNPKTSYLAALSAIATLKSISYPIRVGT",
"proteome": null,
"gene": "nadX",
"go_terms": [
{
"identifier": "GO:0016491",
"name": "oxidoreductase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0050661",
"name": "NADP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0033735",
"name": "aspartate dehydrogenase [NAD(P)+] activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009435",
"name": "NAD+ biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4525b20d818053cf6ccef442780e35bc81f827de",
"counters": {
"domain_architectures": 3952,
"entries": 18,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"pfam": 2,
"panther": 1,
"pirsf": 1,
"hamap": 1,
"ncbifam": 3,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 3952
}
}
}