GET /api/protein/UniProt/A0A7G3B8W2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7G3B8W2",
        "id": "A0A7G3B8W2_LUTLO",
        "source_organism": {
            "taxId": "7200",
            "scientificName": "Lutzomyia longipalpis",
            "fullName": "Lutzomyia longipalpis (Sand fly)"
        },
        "name": "BET1 homolog",
        "description": [
            "Required for vesicular transport from the ER to the Golgi complex. Functions as a SNARE involved in the docking process of ER-derived vesicles with the cis-Golgi membrane"
        ],
        "length": 114,
        "sequence": "MRRSQGYSYQPLPQSAPSTSHDALEEENERMAEELKGKIGALKTLTIDIGNEVRHQDRLLAGMDDDMESTFGVLKNTMGRVLRLGKGGHRNYMCYMFLFVLGILLLLYVVLKFR",
        "proteome": null,
        "gene": null,
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "ssf": 1,
                "profile": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1
        }
    }
}