General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7E6DSM1",
        "id": "A0A7E6DSM1_9CHIR",
        "source_organism": {
            "taxId": "89673",
            "scientificName": "Phyllostomus discolor",
            "fullName": "Phyllostomus discolor (pale spear-nosed bat)"
        },
        "name": "Geranylgeranyl transferase type-2 subunit beta",
        "description": [
            "Catalyzes the transfer of a geranylgeranyl moiety from geranylgeranyl diphosphate to both cysteines of proteins with the C-terminal sequence -XXCC, -XCXC and -CCXX"
        ],
        "length": 289,
        "sequence": "MGTPQKDVVIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREEILTFIKSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDINKVVEYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQLPDVCYSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSLLGEEQIKPVSPVFCMPEEVLRRVNVQPELVS",
        "proteome": "UP000504628",
        "gene": "RABGGTB",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004663",
                "name": "Rab geranylgeranyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0018344",
                "name": "protein geranylgeranylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008318",
                "name": "protein prenyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2fd401e44235fc3e11f794d9cc6d0672ffe97862",
        "counters": {
            "domain_architectures": 1246,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1246
        }
    }
}