GET /api/protein/UniProt/A0A7E6DEQ2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7E6DEQ2",
"id": "A0A7E6DEQ2_9CHIR",
"source_organism": {
"taxId": "89673",
"scientificName": "Phyllostomus discolor",
"fullName": "Phyllostomus discolor (pale spear-nosed bat)"
},
"name": "Odontogenic ameloblast-associated protein",
"description": [
"Tooth-associated epithelia protein that probably plays a role in odontogenesis, the complex process that results in the initiation and generation of the tooth. May be incorporated in the enamel matrix at the end of mineralization process. Involved in the induction of RHOA activity via interaction with ARHGEF and expression of downstream factors such as ROCK. Plays a role in attachment of the junctional epithelium to the tooth surface"
],
"length": 278,
"sequence": "MKTIILLGLLGATMSAPLIPQRILSASNSNELLLNLNNAQLQALQLQSPFNSWIPPFSGILQQQAQIPGLAPFSLSTLDQFARLLPNQIPFPRQASFPQGNQVGQLDPSQPQTPVQTQQGPNHQAMPYVFSFKMPQEQAQMFQYYPVYMLLPWEQPQQTVPQPPPQTGQQKFEEQMPFYTEFGNIPQQAEPVIPGGQQQLAFDTFLGTALEPAVMPEGGVIPYLQKEIINFRHASGGIFTPSTSQKPSTTNIFASAIDPTSTPELMEEKAKTGSLKEP",
"proteome": "UP000504628",
"gene": "ODAM",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "45de1c27261561426b423ceb133b715fd2f38f8f",
"counters": {
"domain_architectures": 204,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 204
}
}
}