General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7E6DCF3",
        "id": "A0A7E6DCF3_9CHIR",
        "source_organism": {
            "taxId": "89673",
            "scientificName": "Phyllostomus discolor",
            "fullName": "Phyllostomus discolor (pale spear-nosed bat)"
        },
        "name": "Cleavage and polyadenylation specificity factor subunit 4",
        "description": [
            "Component of the cleavage and polyadenylation specificity factor (CPSF) complex that play a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. CPSF4 binds RNA polymers with a preference for poly(U)"
        ],
        "length": 299,
        "sequence": "MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHALDLNCQWEPLSSPHCRSRRSLQQREPRRSSGSCRVKTAVQATGDPGRWSRSRVTSVVKKDTTPTDAPKGTWPFSVDSDSSWTQLRTTQGAPFWRPLWAILGSVHFNCSMPVLVQLWLELAGKHTGVYQCKGLCQFPYHFAVIFFFFKRRDMCSISVPQVSIMFV",
        "proteome": "UP000504628",
        "gene": "CPSF4",
        "go_terms": [
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3a1eaf33a9d96438613ed7b63b7ac11e91880ff3",
        "counters": {
            "domain_architectures": 1749,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "smart": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1749
        }
    }
}