General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7E5W9K8",
        "id": "A0A7E5W9K8_TRINI",
        "source_organism": {
            "taxId": "7111",
            "scientificName": "Trichoplusia ni",
            "fullName": "Trichoplusia ni (Cabbage looper)"
        },
        "name": "tRNA (Guanine-N(7)-)-methyltransferase non-catalytic subunit wuho",
        "description": [
            "Required for the Mettl1-dependent formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. In the Mettl1-wuho methyltransferase complex, it is required to stabilize and induce conformational changes of the catalytic subunit. Required for binding of nanos mRNA and repression of translation by the mei-P26-bgcn-bam-sxl complex. May cooperate with mei-P26 and nanos to derepress the BMP signaling pathway. May cooperate with mei-P26 to suppress expression of a subset of microRNAs. May cooperate with mei-P26 to regulate bam expression levels in germline cells during gametogenesis. Required to promote mitosis to meiosis transition during gametogenesis. May regulate germline cell division in part by regulating ribosome biogenesis",
            "Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. In the complex, it is required to stabilize and induce conformational changes of the catalytic subunit"
        ],
        "length": 376,
        "sequence": "MSLLVATDKYIALAKDLHIDYYDYTDHKIVDIPLLPKQPEKDYISDIAVSNDAKHLALVTASSKQLMIYDLCKMEHQTTFIIPRSASRIRFTVDNTKLLVADKSGDVLIYDIMKKDSGTKLLGHLSLLLDVLQSNDSKYIISCDRDEKIKVSCYPKTYSIQTYCLGHKEYVNHIEFLPHNDKYLTSSSGDGTLKIWDYSEGKLYHTIDTKFDVKDEQLRQNFINIMDEGGIEVATLPIVHYTTTKNNNSSSLLAITVHSYNAVIIYSVTIEDNSFSHKLEKRLELPRFPAAINLFNKTLFVYDNVECNINVFKIVAEGGNFSLEEPSKIAMFKNKNIQSDSEQVQLESIKVLYKRKFDNVQEYQERKKLRLQKSTK",
        "proteome": "UP000322000",
        "gene": "LOC113500666",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0036265",
                "name": "RNA (guanine-N7)-methylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5a1e7e096f9d8c9417e859b3237d576a7f277f97",
        "counters": {
            "domain_architectures": 73335,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 2,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 73335
        }
    }
}