General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7E5VFN2",
        "id": "A0A7E5VFN2_TRINI",
        "source_organism": {
            "taxId": "7111",
            "scientificName": "Trichoplusia ni",
            "fullName": "Trichoplusia ni (Cabbage looper)"
        },
        "name": "Structure-specific endonuclease subunit SLX1 homolog",
        "description": [
            "Catalytic subunit of a heterodimeric structure-specific endonuclease that resolves DNA secondary structures generated during DNA repair and recombination. Has endonuclease activity towards branched DNA substrates, introducing single-strand cuts in duplex DNA close to junctions with ss-DNA"
        ],
        "length": 286,
        "sequence": "MSDIVPEIVEDFFGVYLLYCINPRYKGRTYIGYTRDPNRRIMQHNRGTWAGGAHRTNNKGPWKMVMIVHGFPNNISALRFEWAWQNPTKTIRLQHLNLKKVPRKESEFKFKLRVLSEMLRVGPWFRLPLIIRWLETEYIEEFPPERKPPDHMTIVQGPVKSRNLKRKLLNTTFTEECLLCSNYINIGQAKTTCLNPSCELLAHITCLADLFLVPGEYVPIEGNCPFCSTKLKWGDIIRKMKGCAQPGEEVIGEECAEEECLEEECITEEDKADEYPSWFLDCNDDL",
        "proteome": "UP000322000",
        "gene": "LOC113493349",
        "go_terms": [
            {
                "identifier": "GO:0017108",
                "name": "5'-flap endonuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0033557",
                "name": "Slx1-Slx4 complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d65708900b98df992ebce96a1f0d89ea8b4ffe66",
        "counters": {
            "domain_architectures": 2312,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "profile": 1,
                "cdd": 1,
                "smart": 1,
                "pfam": 2,
                "ssf": 1,
                "hamap": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2312
        }
    }
}