HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7D5XFU3",
"id": "A0A7D5XFU3_FERL1",
"source_organism": {
"taxId": "2795018",
"scientificName": "Fermentimicrarchaeum limneticum",
"fullName": "Fermentimicrarchaeum limneticum"
},
"name": "Geranylgeranylglyceryl phosphate synthase",
"description": [
"Prenyltransferase that catalyzes the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P). This reaction is the first ether-bond-formation step in the biosynthesis of archaeal membrane lipids"
],
"length": 256,
"sequence": "MRSMGKVEKYINDGIQREGALLFVLIDPLDYPTLDKAVQTAGEACDAGADIILIGGSIGVQGHILDEVTKRIKEKVNVPIVLFPGNTGTLTRFADAVYFMQLLNSRNPYWISQAQALAAPIVKQIGIEPLAVGYIVVEPGGTVGWVGDANKVPRGKAQIAAFLALAGEYAGSKIIVTDVGSASELGPVPLEMVKAVRKVTSVPYIVAGGIKTKHQAAEIVKAGADAIHIGTAAQDSKHVGKTVKGFVKAIKEAGRR",
"proteome": null,
"gene": "Sv326_1238",
"go_terms": [
{
"identifier": "GO:0016765",
"name": "transferase activity, transferring alkyl or aryl (other than methyl) groups",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000287",
"name": "magnesium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0047294",
"name": "phosphoglycerol geranylgeranyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006650",
"name": "glycerophospholipid metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1c0fcefa23eed8f8a6dab6c4166e589497aace97",
"counters": {
"domain_architectures": 4309,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"ssf": 1,
"ncbifam": 3,
"panther": 1,
"hamap": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 4309
}
}
}