GET /api/protein/UniProt/A0A7D5XFU3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7D5XFU3",
        "id": "A0A7D5XFU3_FERL1",
        "source_organism": {
            "taxId": "2795018",
            "scientificName": "Fermentimicrarchaeum limneticum",
            "fullName": "Fermentimicrarchaeum limneticum"
        },
        "name": "Geranylgeranylglyceryl phosphate synthase",
        "description": [
            "Prenyltransferase that catalyzes the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P). This reaction is the first ether-bond-formation step in the biosynthesis of archaeal membrane lipids"
        ],
        "length": 256,
        "sequence": "MRSMGKVEKYINDGIQREGALLFVLIDPLDYPTLDKAVQTAGEACDAGADIILIGGSIGVQGHILDEVTKRIKEKVNVPIVLFPGNTGTLTRFADAVYFMQLLNSRNPYWISQAQALAAPIVKQIGIEPLAVGYIVVEPGGTVGWVGDANKVPRGKAQIAAFLALAGEYAGSKIIVTDVGSASELGPVPLEMVKAVRKVTSVPYIVAGGIKTKHQAAEIVKAGADAIHIGTAAQDSKHVGKTVKGFVKAIKEAGRR",
        "proteome": null,
        "gene": "Sv326_1238",
        "go_terms": [
            {
                "identifier": "GO:0016765",
                "name": "transferase activity, transferring alkyl or aryl (other than methyl) groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0047294",
                "name": "phosphoglycerol geranylgeranyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006650",
                "name": "glycerophospholipid metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005737",
                "name": "cytoplasm",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1c0fcefa23eed8f8a6dab6c4166e589497aace97",
        "counters": {
            "domain_architectures": 4309,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "ssf": 1,
                "ncbifam": 3,
                "panther": 1,
                "hamap": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 4309
        }
    }
}