GET /api/protein/UniProt/A0A7D5E7J4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7D5E7J4",
        "id": "A0A7D5E7J4_9EURY",
        "source_organism": {
            "taxId": "536044",
            "scientificName": "Methanolobus zinderi",
            "fullName": "Methanolobus zinderi"
        },
        "name": "Endonuclease III",
        "description": [
            "DNA repair enzyme that has both DNA N-glycosylase activity and AP-lyase activity. The DNA N-glycosylase activity releases various damaged pyrimidines from DNA by cleaving the N-glycosidic bond, leaving an AP (apurinic/apyrimidinic) site. The AP-lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate"
        ],
        "length": 218,
        "sequence": "MAKEVPAVADNTANFERIFELLKQEYPNAAPALHFKNELELLVATILSAQSTDRQVNQVTKTLFKKYRTVEDYANADITEFGKDIYSTGFYRQKTKHIIGSAQLMLTDFGGQVPDTMEGLLQLPGVGRKTANIVLSRAFGKIEGIAVDTHVKRLSRRLGFTQETDPEKIEQDLMSIAEREELETLSMTLILHGRNVCIARKPKCEICVVNKLCPSSRV",
        "proteome": "UP000509594",
        "gene": "nth",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006284",
                "name": "base-excision repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051539",
                "name": "4 iron, 4 sulfur cluster binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003906",
                "name": "DNA-(apurinic or apyrimidinic site) endonuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7689873d5b659f892cce3a9d61a84a789067fc8a",
        "counters": {
            "domain_architectures": 17005,
            "entries": 23,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "cdd": 1,
                "pfam": 3,
                "smart": 2,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 1,
                "pirsf": 1,
                "prosite": 2,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 17005
        }
    }
}