HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7D5E7J4",
"id": "A0A7D5E7J4_9EURY",
"source_organism": {
"taxId": "536044",
"scientificName": "Methanolobus zinderi",
"fullName": "Methanolobus zinderi"
},
"name": "Endonuclease III",
"description": [
"DNA repair enzyme that has both DNA N-glycosylase activity and AP-lyase activity. The DNA N-glycosylase activity releases various damaged pyrimidines from DNA by cleaving the N-glycosidic bond, leaving an AP (apurinic/apyrimidinic) site. The AP-lyase activity cleaves the phosphodiester bond 3' to the AP site by a beta-elimination, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate"
],
"length": 218,
"sequence": "MAKEVPAVADNTANFERIFELLKQEYPNAAPALHFKNELELLVATILSAQSTDRQVNQVTKTLFKKYRTVEDYANADITEFGKDIYSTGFYRQKTKHIIGSAQLMLTDFGGQVPDTMEGLLQLPGVGRKTANIVLSRAFGKIEGIAVDTHVKRLSRRLGFTQETDPEKIEQDLMSIAEREELETLSMTLILHGRNVCIARKPKCEICVVNKLCPSSRV",
"proteome": "UP000509594",
"gene": "nth",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006281",
"name": "DNA repair",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006284",
"name": "base-excision repair",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051539",
"name": "4 iron, 4 sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003906",
"name": "DNA-(apurinic or apyrimidinic site) endonuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7689873d5b659f892cce3a9d61a84a789067fc8a",
"counters": {
"domain_architectures": 17005,
"entries": 23,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 2,
"cdd": 1,
"pfam": 3,
"smart": 2,
"hamap": 1,
"panther": 1,
"ncbifam": 1,
"pirsf": 1,
"prosite": 2,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17005
}
}
}