HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7C7ZDY5",
"id": "A0A7C7ZDY5_9ARCH",
"source_organism": {
"taxId": "2173149",
"scientificName": "Marine Group III euryarchaeote",
"fullName": "Marine Group III euryarchaeote"
},
"name": "CTP synthase",
"description": [
"Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as the source of nitrogen. Regulates intracellular CTP levels through interactions with the four ribonucleotide triphosphates"
],
"length": 531,
"sequence": "MKYIIVTGGVLSGLGKGVTASSIGVLLQRAGYRVTAVKMDPYLNCDAGTMNPYEHGEVFVMTDGSEVDLDLGNYERFLNCNLTAVHNITTGKVFRSVIEKERRGDYLGQTVQIIPHVVREIVDAMRDAAESASAEICLVELGGTVGDIESMPFMEAVRQLHREEKHENVMFIHTTLVPVIGAVGEQKTKPTQHSVKELQGLGIRPDVIVGRSTDPLEPDIAAKIAFFADIPPENVVSAPDAKSIYDVPMHFVDQQVPQLIEERLELKRREPDMTQWQNFAERISNGTREVEIALIGKYTDLKDSYISHEETLRYTGALEDCRVRIRWLEAPDLEEAGNAAALEGVNGVVVPGGFGNRGAEGKIMAAQWARENRVPYLGVCFGFQLAVIEFCRNVLDLKGANSSELDPDSPHHVVDLLPEQREVTEMGATMRLGDHDVALDEGIASKLYGSDSIQERHRHRFEINPDYIERIEAAGMRFTGRDTSGRRMEVLELEGHPYFLASQFHPEFKSRPDAPSPLHLGLVRAALEHAA",
"proteome": null,
"gene": "pyrG",
"go_terms": [
{
"identifier": "GO:0003883",
"name": "CTP synthase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006221",
"name": "pyrimidine nucleotide biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006241",
"name": "CTP biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5fd849ee322c87077b670104fc9e7b1197769099",
"counters": {
"domain_architectures": 33489,
"entries": 19,
"isoforms": 0,
"proteomes": 0,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"cdd": 2,
"pfam": 2,
"profile": 1,
"ncbifam": 2,
"panther": 1,
"hamap": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 33489
}
}
}