General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A7C3ETQ1",
        "id": "A0A7C3ETQ1_9CREN",
        "source_organism": {
            "taxId": "1867258",
            "scientificName": "Candidatus Methanomethylicus mesodigestus",
            "fullName": "Candidatus Methanomethylicus mesodigestus"
        },
        "name": "Probable inosine/xanthosine triphosphatase",
        "description": [
            "Phosphatase that hydrolyzes non-canonical purine nucleotides such as XTP and ITP to their respective diphosphate derivatives. Probably excludes non-canonical purines from DNA/RNA precursor pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions"
        ],
        "length": 182,
        "sequence": "MIVAVGSSNPVKVKAVENVLSKFFSVSVVAMDVETGVPPQPIGADVTIRGAICRAMAAIRSEPSADLGVGIESGLLEFPSTISGFMDQQFAAIVDQDGAITLGGGPAFEYPLVIINKVISERTEINDAMGALTGIKGLGRKEGAIGYFSKGRLDRTRLTEQAVLMALIPRLNKDLYFASQPR",
        "proteome": null,
        "gene": "yjjX",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "38ce8f249c08c196d08111994734ea2422dd1f22",
        "counters": {
            "domain_architectures": 5882,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 2,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 5882
        }
    }
}