GET /api/protein/UniProt/A0A7C3ETQ1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A7C3ETQ1",
"id": "A0A7C3ETQ1_9CREN",
"source_organism": {
"taxId": "1867258",
"scientificName": "Candidatus Methanomethylicus mesodigestus",
"fullName": "Candidatus Methanomethylicus mesodigestus"
},
"name": "Probable inosine/xanthosine triphosphatase",
"description": [
"Phosphatase that hydrolyzes non-canonical purine nucleotides such as XTP and ITP to their respective diphosphate derivatives. Probably excludes non-canonical purines from DNA/RNA precursor pool, thus preventing their incorporation into DNA/RNA and avoiding chromosomal lesions"
],
"length": 182,
"sequence": "MIVAVGSSNPVKVKAVENVLSKFFSVSVVAMDVETGVPPQPIGADVTIRGAICRAMAAIRSEPSADLGVGIESGLLEFPSTISGFMDQQFAAIVDQDGAITLGGGPAFEYPLVIINKVISERTEINDAMGALTGIKGLGRKEGAIGYFSKGRLDRTRLTEQAVLMALIPRLNKDLYFASQPR",
"proteome": null,
"gene": "yjjX",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "38ce8f249c08c196d08111994734ea2422dd1f22",
"counters": {
"domain_architectures": 5882,
"entries": 11,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 2,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 5882
}
}
}