GET /api/protein/UniProt/A0A741SKK4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A741SKK4",
"id": "A0A741SKK4_SALER",
"source_organism": {
"taxId": "1151166",
"scientificName": "Salmonella enterica subsp. arizonae serovar 41:z4,z23:-",
"fullName": "Salmonella enterica subsp. arizonae serovar 41:z4,z23:-"
},
"name": "D-methionine transport system permease protein MetI",
"description": [
"Part of the binding-protein-dependent transport system for D-methionine and the toxic methionine analog alpha-methyl-methionine. Probably responsible for the translocation of the substrate across the membrane"
],
"length": 219,
"sequence": "MDDLLPDLTLAFNETFQMLSISTVLAILGGLPLGFLIFVTDRHLFWQNRFIYLVASVLVNIIRSVPFVILLVLLLPLTQLLLGNTIGPIAASVPLSVAAIAFYARLVDSALREVDKGVIEAALAFGASPIRIICTVLLPEASAGLLRGLTITLVSLIGYSAMAGIVGGGGVGDLAIRYGYYRYETEVMVVTVVALIVLVQVVQMLGDWLAKRADKRDRH",
"proteome": null,
"gene": "G9G42_003364",
"go_terms": [
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "149ba0064877cb2f3007f9b95b1a3d82ad06c810",
"counters": {
"domain_architectures": 894065,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"profile": 1,
"cdd": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 894065
}
}
}