GET /api/protein/UniProt/A0A735NJ95/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A735NJ95",
        "id": "A0A735NJ95_SALPA",
        "source_organism": {
            "taxId": "295319",
            "scientificName": "Salmonella paratyphi A (strain ATCC 9150 / SARB42)",
            "fullName": "Salmonella paratyphi A (strain ATCC 9150 / SARB42)"
        },
        "name": "Dual-action ribosomal maturation protein DarP",
        "description": [
            "Member of a network of 50S ribosomal subunit biogenesis factors which assembles along the 30S-50S interface, preventing incorrect 23S rRNA structures from forming. Promotes peptidyl transferase center (PTC) maturation"
        ],
        "length": 183,
        "sequence": "MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKRLGAELVDLGKNALDKIPLDTDLRDAIELAQRIKMEGRRRQLQLIGKMLRQRDVEPIRQALDKLKNRHNQQVVLFHKLEHLRDRLIVEGDDAVAEVLTLWPHADRQQLRSLIRNAKKEKEGNKPPKSARQIFQYLRELAENEG",
        "proteome": null,
        "gene": "darP",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6a8cedc71676e2bbe6dd350c3e9c649fa1bf0740",
        "counters": {
            "domain_architectures": 6848,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pirsf": 1,
                "hamap": 1,
                "pfam": 1,
                "ncbifam": 1,
                "interpro": 2
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 6848
        }
    }
}