HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A719X628",
"id": "A0A719X628_SALTI",
"source_organism": {
"taxId": "497977",
"scientificName": "Salmonella enterica subsp. enterica serovar Typhi str. 404ty",
"fullName": "Salmonella enterica subsp. enterica serovar Typhi str. 404ty"
},
"name": "Hydrogenase-2 small chain",
"description": [
"This is one of three E.coli hydrogenases synthesized in response to different physiological conditions. HYD2 is involved in hydrogen uptake"
],
"length": 372,
"sequence": "MTGDNTLITSHGINRRDFMKLCAALAATMGLSSKAAAEMAESVSNPQRPPVIWIGAQECTGCTESLLRATHPTVENLVLETISLEYHEVLSAAFGHQVEENKHNALEKYKGQYVLVVDGSIPLKDNGIYCMVAGEPIVDHIRKAADGAAAIIAIGSCSAWGGVAAAGVNPTGAVSLQEVLAGKTVINIPGCPPNPHNFLATVAHIITYGTPPKLDAKNRPTFAYGRLIHEHCERRPHFDAGRFAKEFGDEGHRQGWCLYHLGCKGPETWGNCSTLQFCDVGGVWPVAIGHPCYGCNEEGIGFHKGIHQLAHVENQTPRSEKPDVNMKEGGNISAGAVGLLGGVVGLVAGVSVMAVRELGRQQKKDNADSRGE",
"proteome": null,
"gene": "G1Y70_07570",
"go_terms": [
{
"identifier": "GO:0051536",
"name": "iron-sulfur cluster binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008901",
"name": "ferredoxin hydrogenase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009375",
"name": "ferredoxin hydrogenase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ddabda789654f3daae5a3a3d28464c807a640443",
"counters": {
"domain_architectures": 6905,
"entries": 19,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"ncbifam": 3,
"cathgene3d": 2,
"ssf": 1,
"pfam": 2,
"pirsf": 1,
"panther": 1,
"prints": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 6905
}
}
}