GET /api/protein/UniProt/A0A719AL55/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A719AL55",
"id": "A0A719AL55_SALTS",
"source_organism": {
"taxId": "216597",
"scientificName": "Salmonella typhimurium (strain SL1344)",
"fullName": "Salmonella typhimurium (strain SL1344)"
},
"name": "Thiol:disulfide interchange protein",
"description": [
"Required for disulfide bond formation in some periplasmic proteins. Acts by transferring its disulfide bond to other proteins and is reduced in the process"
],
"length": 237,
"sequence": "MKKRFMMFTLLAAVFSGVAHADDAAIRQSLAKLGVQSTEIQASPVAGMKTVLTHSGVLYVTDDGKHIIQGPMYDVSGAHPVNVTNKLLMSQLNALEKEMIVYKAPDEKHVITVFTDITCGYCHKLHEEMKDYNALGITVRYLAFPRQGLESQAEQDMKSIWCAKDKNKAFDDAMAGKGVKPASCDVNIADHYALGVQLGVSGTPAIVLSNGYVVPGYQGPKEMKAFLDEHQKQTSGK",
"proteome": null,
"gene": "dsbC",
"go_terms": [
{
"identifier": "GO:0042597",
"name": "periplasmic space",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "411dc6ad206d244ac3dc75130cf3acae00785523",
"counters": {
"domain_architectures": 9553,
"entries": 17,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 2,
"cathgene3d": 2,
"ssf": 2,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 9553
}
}
}