General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A715S4L2",
        "id": "A0A715S4L2_SALTI",
        "source_organism": {
            "taxId": "220341",
            "scientificName": "Salmonella enterica subsp. enterica serovar Typhi str. CT18",
            "fullName": "Salmonella enterica subsp. enterica serovar Typhi str. CT18"
        },
        "name": "Acid stress chaperone HdeB",
        "description": [
            "Required for optimal acid stress protection, which is important for survival of enteric bacteria in the acidic environment of the host stomach. Exhibits a chaperone-like activity at acidic pH by preventing the aggregation of many different periplasmic proteins"
        ],
        "length": 109,
        "sequence": "MNKFSLATAGIIVAALVTSVSVNAATDTTKTNVTPKGMSCQEFVDLNPQTMAPVAFWVLNEDEDFKGGDYVDFQETETTAVPLAVELCKKNPQSELSKIKDEIKKELSK",
        "proteome": null,
        "gene": "hdeB",
        "go_terms": [
            {
                "identifier": "GO:0051082",
                "name": "unfolded protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009268",
                "name": "response to pH",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fd4fc2aa63f7a42ff9159e954ff9981f5f21fdb7",
        "counters": {
            "domain_architectures": 1575,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "cathgene3d": 1,
                "hamap": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 1575
        }
    }
}