General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A715HXI6",
        "id": "A0A715HXI6_SALTI",
        "source_organism": {
            "taxId": "220341",
            "scientificName": "Salmonella enterica subsp. enterica serovar Typhi str. CT18",
            "fullName": "Salmonella enterica subsp. enterica serovar Typhi str. CT18"
        },
        "name": "Phosphocarrier protein NPr",
        "description": [
            "Component of the phosphoenolpyruvate-dependent nitrogen-metabolic phosphotransferase system (nitrogen-metabolic PTS), that seems to be involved in regulating nitrogen metabolism. The phosphoryl group from phosphoenolpyruvate (PEP) is transferred to the phosphoryl carrier protein NPr by enzyme I-Ntr. Phospho-NPr then transfers it to EIIA-Ntr. Could function in the transcriptional regulation of sigma-54 dependent operons in conjunction with the NPr (PtsO) and EIIA-Ntr (PtsN) proteins"
        ],
        "length": 90,
        "sequence": "MTVKQTVEVTNKLGMHARPAMKLFELMQGFDAEVLLRNDEGTEAEANSVIALLMLDSAKGRQIEIEATGPQEVEALAAVIALFNSGFDED",
        "proteome": null,
        "gene": "GYJ61_06100",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "949e40f21cba13b01845a0586f640aa7a6558887",
        "counters": {
            "domain_architectures": 27664,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "profile": 1,
                "pfam": 1,
                "ssf": 1,
                "cdd": 1,
                "ncbifam": 2,
                "panther": 1,
                "prosite": 2,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 27664
        }
    }
}