HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A714VZF7",
"id": "A0A714VZF7_SALTI",
"source_organism": {
"taxId": "220341",
"scientificName": "Salmonella enterica subsp. enterica serovar Typhi str. CT18",
"fullName": "Salmonella enterica subsp. enterica serovar Typhi str. CT18"
},
"name": "HTH-type transcriptional repressor PurR",
"description": [
"Is the main repressor of the genes involved in the de novo synthesis of purine nucleotides, regulating purB, purC, purEK, purF, purHD, purL, purMN and guaBA expression. PurR is allosterically activated to bind its cognate DNA by binding the purine corepressors, hypoxanthine or guanine, thereby effecting transcription repression"
],
"length": 341,
"sequence": "MATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVARSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNLEKQRAYLSMMAQKRVDGLLVMCSEYPEPLLSMLEEYRHIPMVVMDWGEAKADFTDTVIDNAFAGGYMAGRYLVERGHRDIGVIPGPLERNTGAGRLAGFMKAMEEALINVPDNWIVQGDFEPESGYHAMQQILSQSHRPTAVFCGGDIMAMGALCAADEMGLRVPQDVSVIGYDNVRNARFFTPALTTIHQPKDSLGETAFNMLLDRIVNKREESQSIEVHPRLVERRSVADGPFRDYRR",
"proteome": null,
"gene": "purR",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8baa56cf8098fc11ded39a5605ac293ed17c19f6",
"counters": {
"domain_architectures": 163415,
"entries": 21,
"isoforms": 0,
"proteomes": 0,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"smart": 1,
"profile": 1,
"pfam": 2,
"cathgene3d": 2,
"cdd": 2,
"panther": 1,
"hamap": 1,
"ncbifam": 1,
"prints": 1,
"prosite": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 163415
}
}
}