HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A702BPR4",
"id": "A0A702BPR4_SALBN",
"source_organism": {
"taxId": "1967585",
"scientificName": "Salmonella bongori serovar 44:r:-",
"fullName": "Salmonella bongori serovar 44:r:-"
},
"name": "Formyltetrahydrofolate deformylase",
"description": [
"Catalyzes the hydrolysis of 10-formyltetrahydrofolate (formyl-FH4) to formate and tetrahydrofolate (FH4)"
],
"length": 280,
"sequence": "MQSLQRKVLRTICPDQKGLIARITNICYKHELNIVQNNEFVDHRTGRFFMRTELEGIFNDATLLADLDSALPEGSVRELNPAGRRRVVILVTKEAHCLGDLLMKANYGGLDVEIAAVIGNHETLRSLVERFEIPFELVSHEGLTREEHDSKMADAIDAHQPDYVVLAKYMRVLTPEFVARFPNKIINIHHSFLPAFIGARPYHQAYERGVKIIGATAHYVNDNLDEGPIIMQDVIHVDHTYTAEDMMRAGRDVEKNVLSRALYQVLAQRVFVYGNRTIIL",
"proteome": null,
"gene": "purU",
"go_terms": [
{
"identifier": "GO:0008864",
"name": "formyltetrahydrofolate deformylase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009058",
"name": "biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006189",
"name": "'de novo' IMP biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "a4d8960a650ba3ddb666c432b141596c6efb45f0",
"counters": {
"domain_architectures": 11048,
"entries": 22,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"cdd": 2,
"profile": 1,
"panther": 1,
"ncbifam": 2,
"hamap": 1,
"pirsf": 1,
"prints": 1,
"interpro": 7
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 11048
}
}
}