GET /api/protein/UniProt/A0A702BP73/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A702BP73",
"id": "A0A702BP73_SALBN",
"source_organism": {
"taxId": "1967585",
"scientificName": "Salmonella bongori serovar 44:r:-",
"fullName": "Salmonella bongori serovar 44:r:-"
},
"name": "Regulator of ribonuclease activity A",
"description": [
"Globally modulates RNA abundance by binding to RNase E (Rne) and regulating its endonucleolytic activity. Can modulate Rne action in a substrate-dependent manner by altering the composition of the degradosome. Modulates RNA-binding and helicase activities of the degradosome"
],
"length": 161,
"sequence": "MKYDTSELCDIYQEDVNVVEPLFSNFGGRSSFGGQIITVKCFEDNGLLYDLLEQNGRGRVLLVDGGGSVRRALVDAELARLAAQNEWEGLVVYGAVRQVDELEELDIGIQAIAAIPVGAAGEGIGESDIRVNFGGVTFFSGDHLYADNTGIILSEDPLDIE",
"proteome": null,
"gene": "rraA",
"go_terms": [
{
"identifier": "GO:0008428",
"name": "ribonuclease inhibitor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0051252",
"name": "regulation of RNA metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7ba918e63a501c46e37074330479cf2ec61ab795",
"counters": {
"domain_architectures": 30296,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"ncbifam": 3,
"hamap": 1,
"panther": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 30296
}
}
}