HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A702BLI0",
"id": "A0A702BLI0_SALBN",
"source_organism": {
"taxId": "1967585",
"scientificName": "Salmonella bongori serovar 44:r:-",
"fullName": "Salmonella bongori serovar 44:r:-"
},
"name": "Nickel-responsive regulator",
"description": [
"Transcriptional repressor of the nikABCDE operon. Is active in the presence of excessive concentrations of intracellular nickel"
],
"length": 132,
"sequence": "MQRVTITLDDDLLETLDSLSQRRGYNNRSEAIRDILRGALAQETTQEHGTQGFAVLSYVYEHEKRDLASRIVSTQHHHHDLSVATLHVHINHDDCLEIAVLKGDMGDVQHFADDVISQRGVRHGHLQCLPKE",
"proteome": null,
"gene": "nikR",
"go_terms": [
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016151",
"name": "nickel cation binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0010045",
"name": "response to nickel cation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "170ea852c654961e4d83dfb7875fa2ce03ed6b26",
"counters": {
"domain_architectures": 3705,
"entries": 21,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"pfam": 2,
"cdd": 1,
"hamap": 1,
"panther": 1,
"ncbifam": 3,
"interpro": 9
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 3705
}
}
}