GET /api/protein/UniProt/A0A6V8QX76/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6V8QX76",
"id": "A0A6V8QX76_TRIAP",
"source_organism": {
"taxId": "101201",
"scientificName": "Trichoderma asperellum",
"fullName": "Trichoderma asperellum (Filamentous fungus)"
},
"name": "Ribosome biogenesis protein NSA2 homolog",
"description": [
"Involved in the biogenesis of the 60S ribosomal subunit. May play a part in the quality control of pre-60S particles"
],
"length": 260,
"sequence": "MPQNEYMERWRKLHGRRLDHEERTRKRIAREGHKASQDAQNLRGLKAKLYQKKRHNEKIQMKKAIKAHEERNVKTADEKEPTQPLPSYLLDRSNPSTAKALSSAIKNKRAEKAAKFSVPLPKVRGISEEEMFKVVKTGKKTHKRAWKRVITKPTFVGPDFTRRNPKYERFIRPMGLRYKKANVTHPELGVTVQLPIISVKKNPQNPLYTQLGVLTKGTILEVNVSELGLVTAGGKVVWGRYAQVTNNPENEGCINSVLLV",
"proteome": null,
"gene": "TASIC1_0006058600",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "15743871b385ad83e47d1c45d5fe1037ac7640d3",
"counters": {
"domain_architectures": 13001,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 13001
}
}
}