HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6S6QS93",
"id": "A0A6S6QS93_9FIRM",
"source_organism": {
"taxId": "433286",
"scientificName": "Anaerocolumna cellulosilytica",
"fullName": "Anaerocolumna cellulosilytica"
},
"name": "Adenine phosphoribosyltransferase",
"description": [
"Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis"
],
"length": 174,
"sequence": "MKKLEEYVRSIPDFPEEGIVFRDVTSVLQDKDSLKMSIDQMQSLLDDVDIDVVVGPESRGFIFGVPIAYNLNKAFVPVRKKGKLPCETIEMEYALEYGTATIEMHKDAIKPGQRVAIIDDLIATGGTIEAITKLIESLGGIVVKIIFLMELEGLHGRDKLKGYDVEAVIKYEGK",
"proteome": "UP000515561",
"gene": "apt",
"go_terms": [
{
"identifier": "GO:0003999",
"name": "adenine phosphoribosyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006168",
"name": "adenine salvage",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0f8ac38f062a402c09070bf5cbec330fb03fbefd",
"counters": {
"domain_architectures": 136430,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 1,
"cdd": 1,
"ncbifam": 4,
"panther": 1,
"hamap": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 136430
}
}
}