General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P9D0H1",
        "id": "A0A6P9D0H1_PANGU",
        "source_organism": {
            "taxId": "94885",
            "scientificName": "Pantherophis guttatus",
            "fullName": "Pantherophis guttatus (Corn snake)"
        },
        "name": "CCAAT/enhancer-binding protein",
        "description": [
            "Transcription activator that recognizes two different DNA motifs: the CCAAT homology common to many promoters and the enhanced core homology common to many enhancers. Important transcription factor regulating the expression of genes involved in immune and inflammatory responses. Transcriptional activator that enhances IL6 transcription alone and as heterodimer with CEBPB"
        ],
        "length": 316,
        "sequence": "MSAATLDPLDSLSCYRTWSLEPANFYDAKAGEGSGGLSPSCKASSVSVTQASEESGGMCSAPSSGSRDLAELSAAAPAMYEDESAIDFSSYIDSMAAVPNLELCNDELFADLFNSNHKGGERSGGYGDYLPPPQAPPPPASGGSALASLLHASVFPGPLRGAVKQEPEWGEEASSSLLPSQIATCAQTIVNLSGQPTPPTSPEPPGSASPSSYSSRSSASSSSGSKERSGKKGVDRFSPEYRQRRERNNIAVRKSRDKAKRRNQDMQQKLVELSAENDRLHKKIEQLSRDLTSLRHFFKQLPNASFLQPSSVTDCR",
        "proteome": "UP001652622",
        "gene": "CEBPD",
        "go_terms": [
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006351",
                "name": "DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "a717fccfe9f8231ef9b8e8f55ac365baa9863a41",
        "counters": {
            "domain_architectures": 26457,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 1,
                "smart": 1,
                "profile": 1,
                "pirsf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 26457
        }
    }
}