GET /api/protein/UniProt/A0A6P9CRC9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P9CRC9",
"id": "A0A6P9CRC9_PANGU",
"source_organism": {
"taxId": "94885",
"scientificName": "Pantherophis guttatus",
"fullName": "Pantherophis guttatus (Corn snake)"
},
"name": "DNA polymerase epsilon subunit 4",
"description": [
"Accessory component of the DNA polymerase epsilon complex. Participates in DNA repair and in chromosomal DNA replication"
],
"length": 119,
"sequence": "MAAPAAAGGSAAAPEELEAPVAAAVAPAATAAAVAGPSRPARLPLSRVKALVKADPDVTLASQEAVFVLARAAELFVETISKDAFIHTQHGKRKTLQRKDLDNAIEALDEFAFLEGTLD",
"proteome": "UP001652622",
"gene": "POLE4",
"go_terms": [
{
"identifier": "GO:0046982",
"name": "protein heterodimerization activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6df952aa255ac470bf7b0d945c8fb5d61ae9c767",
"counters": {
"domain_architectures": 32824,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"pfam": 1,
"ssf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 32824
}
}
}