GET /api/protein/UniProt/A0A6P9CQA7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P9CQA7",
        "id": "A0A6P9CQA7_PANGU",
        "source_organism": {
            "taxId": "94885",
            "scientificName": "Pantherophis guttatus",
            "fullName": "Pantherophis guttatus (Corn snake)"
        },
        "name": "NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial",
        "description": [
            "Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) which catalyzes electron transfer from NADH through the respiratory chain, using ubiquinone as an electron acceptor. Parts of the peripheral arm of the enzyme, where the electrons from NADH are accepted by flavin mononucleotide (FMN) and then passed along a chain of iron-sulfur clusters by electron tunnelling to the final acceptor ubiquinone. Contains one iron-sulfur cluster"
        ],
        "length": 245,
        "sequence": "MLFSVRFRTAFPRLVTNIRCLYTSAERRSSGGTLFVHRDTPENNPNTPFDFTPENYKRIDGIVNNYPEGHKSSAVIPVLDLAQRQHGWLPISAMNKIAEILQMPPMRVYEVATFYTMFNRKPVGKYHIQICTTTPCMLQDSDSILEAILKKLGIKVGETTSDKLFTVTEVECLGACVNAPMVQINDNYYEDLTTKDIENIIDELKAGNIPKPGPRSGRFSCEPSGGLTSLTQPPKGPGFGVRSDL",
        "proteome": "UP001652622",
        "gene": "NDUFV2",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6b12a71aac7e87df1fa3f5d7b61cab85c53c3b42",
        "counters": {
            "domain_architectures": 28913,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "cdd": 1,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 3,
                "pfam": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 28913
        }
    }
}