GET /api/protein/UniProt/A0A6P9C4M7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P9C4M7",
        "id": "A0A6P9C4M7_PANGU",
        "source_organism": {
            "taxId": "94885",
            "scientificName": "Pantherophis guttatus",
            "fullName": "Pantherophis guttatus (Corn snake)"
        },
        "name": "cAMP-dependent protein kinase inhibitor",
        "description": [
            "Extremely potent competitive inhibitor of cAMP-dependent protein kinase activity, this protein interacts with the catalytic subunit of the enzyme after the cAMP-induced dissociation of its regulatory chains"
        ],
        "length": 75,
        "sequence": "MTDVEPVVTDFAASGRAGRRNALPDILGSSAGAGTSELPHKLAELSMSEGAEGGEASSSDATMENQEMEGKTMNS",
        "proteome": "UP001652622",
        "gene": "PKIB",
        "go_terms": [
            {
                "identifier": "GO:0004862",
                "name": "cAMP-dependent protein kinase inhibitor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006469",
                "name": "negative regulation of protein kinase activity",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "32eeb43e0e7af0c3d1ab36803098211898add135",
        "counters": {
            "domain_architectures": 3412,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pirsf": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3412
        }
    }
}