GET /api/protein/UniProt/A0A6P8Z5W5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P8Z5W5",
"id": "A0A6P8Z5W5_THRPL",
"source_organism": {
"taxId": "161013",
"scientificName": "Thrips palmi",
"fullName": "Thrips palmi (Melon thrips)"
},
"name": "BRISC and BRCA1-A complex member 2",
"description": [
"May play a role in homeostasis or cellular differentiation in cells of neural, epithelial and germline origins. May also act as a death receptor-associated anti-apoptotic protein, which inhibits the mitochondrial apoptotic pathway"
],
"length": 366,
"sequence": "MRSLDKNFRPHLEHLFNSSFNGSFLKPLQLREEQTSAPAIYRDKNVCDHFKLHIPYAGYVLVWEVRFDSNCPEFAPDFLFDDEAFTSFLTIDMLCERVPSLENWDTENPECLTNVIQELLNLYTLFQLKRLEKDGSPLSDECSKLVQEFELKEDQIQVLSGDSPIIPHHYTGSSRPPHDTVSILFLQVEKLLNFEEILGEMALQFNLREFSPNAVLLHMGPVLRNLLGGDVSELEVPSFSRSEGLSSYFGNALRILRETFNQENQSFEKRKEFHLGLRFDLLGLDQLSVIPIENDVPDFTTSSYRIEVDKFCAVLIVRTPRHSTANPRISLRTLSGSSHDVHGGCLWDLQVAIEAIMNSLMDLKAD",
"proteome": "UP000515158",
"gene": "LOC117647558",
"go_terms": [
{
"identifier": "GO:0070531",
"name": "BRCA1-A complex",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0070552",
"name": "BRISC complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4a4796e2c6a0043cd77b182bb1c969901e9eeea2",
"counters": {
"domain_architectures": 2222,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2222
}
}
}