GET /api/protein/UniProt/A0A6P8WI62/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P8WI62",
        "id": "A0A6P8WI62_DROAB",
        "source_organism": {
            "taxId": "7291",
            "scientificName": "Drosophila albomicans",
            "fullName": "Drosophila albomicans (Fruit fly)"
        },
        "name": "Cysteine protease",
        "description": [
            "Cysteine protease that plays a key role in autophagy by mediating both proteolytic activation and delipidation of ATG8 family proteins"
        ],
        "length": 400,
        "sequence": "MLVSLYAQLTRRMDSVFEAYLGPDSILAGAMVNAVGSGEPEDIPKRNTDVWLLGKRYNAIQELDVIRRDIESRLWCTYRHGFVPLGEVQLTSDKGWGCMLRCGQMVLAQALIELHLGRDWFWTRDCRDATYLKIVQRFEDTRKSYYSLHQIALMGESQNKAVGEWLGPNTVAQILKILVRFDEWSSLLVHVAMDSTVVLDDIFERCQQPGEAWQPLLLIVPLRLGITDINPIYIPALKRCLELSSSCGMIGGRPNQALYFLGYVDDEVLYLDPHTTQRAGAVGQKTTQAEQELDESYHQRYAARLSFSAMDPSLAVCFLCKTREQFDELLQQLRQEVLNLSTPSLFEISQSRAVDWDTADDIEWPTMPDIDWPGSNTSDSESFAVLGGSGDVDSKPSAPI",
        "proteome": "UP000515160",
        "gene": "LOC117563223",
        "go_terms": [
            {
                "identifier": "GO:0008234",
                "name": "cysteine-type peptidase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019786",
                "name": "protein-phosphatidylethanolamide deconjugating activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004674",
                "name": "protein serine/threonine kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006468",
                "name": "protein phosphorylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6d3a3c7a42f0bbe649d79e43e20fc010e35776db",
        "counters": {
            "domain_architectures": 8470,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8470
        }
    }
}