HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P8VWB1",
"id": "A0A6P8VWB1_GYMAC",
"source_organism": {
"taxId": "8218",
"scientificName": "Gymnodraco acuticeps",
"fullName": "Gymnodraco acuticeps (Antarctic dragonfish)"
},
"name": "Non-selective voltage-gated ion channel VDAC3",
"description": [
"Non-selective voltage-gated ion channel that mediates the transport of anions and cations through the mitochondrion outer membrane and plasma membrane. Forms a high-conducting channel with a stable open state and a voltage-induced closure with a mild preference for anions over cations. Involved in male fertility and sperm mitochondrial sheath formation"
],
"length": 282,
"sequence": "MAVPPSYTDLGKSAKDIFSKGYGFGVVKLDLKTKSQSGVMEFNTSGSSNTDTGKAAGSLETKYKMKELGLTFNQKWNTDNTLATEVTVEDQLTQGLKVALDTSFVPNTGKKSGKLKTAYKREFVNMGCDVDFEGPIIHAAAVLGYEGWLAGYQMAFDTAKSKLAQNNFALGYKAGDFQLHTNVNDGTEFGGSIFQKVNDDLETAVTLAWTAGSNNTRFGIAAKYKLDKDASLSAKVNNASLIGVGYTQSLRPGVKVTLSALIDGKNFNAGGHKVGMGFELEA",
"proteome": "UP000515161",
"gene": "zgc:56235",
"go_terms": [
{
"identifier": "GO:0008308",
"name": "voltage-gated monoatomic anion channel activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0098656",
"name": "monoatomic anion transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005741",
"name": "mitochondrial outer membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0055085",
"name": "transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b61af2137f24347970cf1481b12e2dc4b115f98c",
"counters": {
"domain_architectures": 17869,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"panther": 1,
"pfam": 1,
"prints": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17869
}
}
}