HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P8SRT5",
"id": "A0A6P8SRT5_GYMAC",
"source_organism": {
"taxId": "8218",
"scientificName": "Gymnodraco acuticeps",
"fullName": "Gymnodraco acuticeps (Antarctic dragonfish)"
},
"name": "Cocaine- and amphetamine-regulated transcript protein",
"description": null,
"length": 164,
"sequence": "MFLLQWPLGRGYGSPYKSGGCPVVGGRSPVELQRLSAPPPLICCLLPGPPPSSSGSTTDSSGMLRGMLFLGLLSVLCHGQASQEVSAEDFGADRPEPATDRDLIEALEALLGRMHDRSPSTEKRGTIALCGMGDRCAMKFGPRIGKLCDCGRGANCNSYLLKCI",
"proteome": "UP000515161",
"gene": "cartl",
"go_terms": [
{
"identifier": "GO:0005184",
"name": "neuropeptide hormone activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007186",
"name": "G protein-coupled receptor signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008343",
"name": "adult feeding behavior",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0032099",
"name": "negative regulation of appetite",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0043410",
"name": "positive regulation of MAPK cascade",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005615",
"name": "extracellular space",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0009267",
"name": "cellular response to starvation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "83f6614153d25297dc27cca7f297747cba7f4a09",
"counters": {
"domain_architectures": 1870,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1870
}
}
}