GET /api/protein/UniProt/A0A6P8SG25/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P8SG25",
"id": "A0A6P8SG25_GEOSA",
"source_organism": {
"taxId": "260995",
"scientificName": "Geotrypetes seraphini",
"fullName": "Geotrypetes seraphini (Gaboon caecilian)"
},
"name": "Nitric oxide synthase-interacting protein",
"description": [
"E3 ubiquitin-protein ligase that is essential for proper development of the forebrain, the eye, and the face. Negatively regulates nitric oxide production by inducing nitric oxide synthase translocation to actin cytoskeleton and inhibiting its enzymatic activity"
],
"length": 295,
"sequence": "MTRHGKNCTAGAVYTYHEKKKDTASSGYGTQTVRLSKDAVKDFDCCCLSLQPCKDPVVTPDGYIYEKEAILEYILHQKKEIARQLKAYEKQRSKLKTEQEELSKAAKESQVKGFLEKEMSIVSKPLNPFTAVSGGPGVDVEPSTSAEERNKQLPSFWIPSLTPEAKATVLKKPNKTIYCPMSGKPLKMKDLTAVKFTPVDDKVDRVGLINRQDRYVCAVTHDMLGNSVPCAVLRPSGAVVTLECVEKLIKKDMVDPINTQKMTEKDIIVLQRGGTGFSGSGVQLQAKESRPVMQA",
"proteome": "UP000515159",
"gene": "NOSIP",
"go_terms": [
{
"identifier": "GO:0061630",
"name": "ubiquitin protein ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "83c482acabf099c0fefc45647ca18faf4f9b04d0",
"counters": {
"domain_architectures": 2553,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"ssf": 1,
"cathgene3d": 1,
"cdd": 2,
"pirsf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2553
}
}
}