GET /api/protein/UniProt/A0A6P8RQ47/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P8RQ47",
        "id": "A0A6P8RQ47_GEOSA",
        "source_organism": {
            "taxId": "260995",
            "scientificName": "Geotrypetes seraphini",
            "fullName": "Geotrypetes seraphini (Gaboon caecilian)"
        },
        "name": "Nucleosome assembly protein 1-like 1 isoform X6",
        "description": [
            "Acts as a chaperone for the linker histone to facilitate deposition of histone B4 onto linker DNA. Required for both remodeling of sperm chromatin into nucleosomes, and linker histone binding to nucleosome core dimers. Plays a role in tissue-specific gene regulation. Required for primitive hemopoiesis, acting upstream of tal1/scl"
        ],
        "length": 399,
        "sequence": "MADIDNSKEQNELDQQDMEDVEDVEEEETGEDANSKARQLTVQMMQNPQILAALQERLDGLVGTSTGYIESLPKVVKRRVNALKNLQVKCAQIEAKFYEEVHELERKYAALYQPLYDKRSEIINAIYEPTEEECEWKTDEEEEISLNLIKEEMKEKAKLEEEKKDEEKEDPKGIPEFWLTVIKNVDLLSDMLQEHDEAILKHLKDIKVKFSETGQPMSFTLEFYFEPNEYFANEVLTKTYKMRSEPDESDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHKGRGTVRTVIKTVPNDSFFNFFTPPEVPESGELDDDAEAILAADFEIGHFLRERIVPRSVLYFTGEAIEDDDDDYDEEGEEADDEEGEEEADEENDPDYDPKKDQNPAECKQQ",
        "proteome": "UP000515159",
        "gene": "NAP1L1",
        "go_terms": [
            {
                "identifier": "GO:0006334",
                "name": "nucleosome assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "44f714239c310ece1f49f7937024a71b5260dbca",
        "counters": {
            "domain_architectures": 18126,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 18126
        }
    }
}