General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P8RIK8",
        "id": "A0A6P8RIK8_GEOSA",
        "source_organism": {
            "taxId": "260995",
            "scientificName": "Geotrypetes seraphini",
            "fullName": "Geotrypetes seraphini (Gaboon caecilian)"
        },
        "name": "Fucosyltransferase",
        "description": [
            "Catalyzes alpha(1->3) linkage of fucosyl moiety transferred from GDP-beta-L-fucose to N-acetyl glucosamine (GlcNAc) within type 2 lactosamine (LacNAc, Gal-beta(1->4)GlcNAc) glycan attached to N- or O-linked glycoproteins. Robustly fucosylates nonsialylated distal LacNAc unit of the polylactosamine chain to form Lewis X antigen (CD15), a glycan determinant known to mediate important cellular functions in development and immunity. Fucosylates with lower efficiency sialylated LacNAc acceptors to form sialyl Lewis X and 6-sulfo sialyl Lewis X determinants that serve as recognition epitopes for C-type lectins. Together with FUT7 contributes to SELE, SELL and SELP selectin ligand biosynthesis and selectin-dependent lymphocyte homing, leukocyte migration and blood leukocyte homeostasis. In a cell type specific manner, may also fucosylate the internal LacNAc unit of the polylactosamine chain to form VIM-2 antigen that serves as recognition epitope for SELE"
        ],
        "length": 341,
        "sequence": "MAKRRRTPRRRCRRRLLAAALTCTALAVYAACGHELARLLRPPPAQTVTVLLWGETFGERPRPGDCKLLFDISDCNVTTDRGRLGQAQAVLFHHHDLGGALPAERPAGQRWVWMNFESPSNTAGLRELGGVFNWTMSYRVGSDIFLPYGYLYARRKEAAAARLPRKSKLLAWVISNWGEEQERVQYYRRLARHVRVDVYGRAGLRLPGDSVLRAVSRYKFYLAFENSQHPDYITEKLWRNAFGASAVPVVLGPSRANYELFVPGDSFIHVDDFSSPRKLAGYLKLLDRNPPLYRRYFAWRKRYQVHVASFWSEHFCTVCQAVRVAGDQLKTVHDLAGWFES",
        "proteome": "UP000515159",
        "gene": "FUT4",
        "go_terms": [
            {
                "identifier": "GO:0008417",
                "name": "fucosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009101",
                "name": "glycoprotein biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7949b5825a229418c69f4bf07e7a1deea5b39a63",
        "counters": {
            "domain_architectures": 11385,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 2,
                "cathgene3d": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11385
        }
    }
}