General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P8P3G0",
        "id": "A0A6P8P3G0_GEOSA",
        "source_organism": {
            "taxId": "260995",
            "scientificName": "Geotrypetes seraphini",
            "fullName": "Geotrypetes seraphini (Gaboon caecilian)"
        },
        "name": "Histone deacetylase complex subunit SAP30L",
        "description": [
            "Functions as a transcription repressor, probably via its interaction with histone deacetylase complexes. Involved in the functional recruitment of the class 1 Sin3-histone deacetylase complex (HDAC) to the nucleolus. Binds DNA, apparently without sequence-specificity, and bends bound double-stranded DNA. Binds phosphoinositol phosphates (phosphoinositol 3-phosphate, phosphoinositol 4-phosphate and phosphoinositol 5-phosphate) via the same basic sequence motif that mediates DNA binding and nuclear import"
        ],
        "length": 195,
        "sequence": "MNGFSTEEDSRDGPPAAASVAAVAAAVAPPAPSAPFFGQSCCLIDDAERCVRPAGNASFSKRIQKSISQKKLKLDIDKSVRHLYICDFHKNFIQSVRNKRKRKTSDDGGDSPEHETDVPEVDLFQLQVNTLRRYKRHYKLQTRPGLNKAQLAETVSRHFRNIQVNEKETLTCFIYMVKSNKGRLEQKSESSKQLE",
        "proteome": "UP000515159",
        "gene": "SAP30L",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "cbe223a1bc114251445b497601c0d919ca43c28e",
        "counters": {
            "domain_architectures": 1947,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "pfam": 2,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1947
        }
    }
}