GET /api/protein/UniProt/A0A6P8NVP5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P8NVP5",
"id": "A0A6P8NVP5_GEOSA",
"source_organism": {
"taxId": "260995",
"scientificName": "Geotrypetes seraphini",
"fullName": "Geotrypetes seraphini (Gaboon caecilian)"
},
"name": "Post-GPI attachment to proteins factor 3",
"description": [
"Involved in the fatty acid remodeling steps of GPI-anchor maturation where the unsaturated acyl chain at sn-2 of inositol phosphate is replaced by a saturated stearoyl chain. May catalyze the first step of the fatty acid remodeling, by removing the unsaturated acyl chain at sn-2 of inositol phosphate, generating a lyso-GPI intermediate. The fatty acid remodeling steps is critical for the integration of GPI-APs into lipid rafts",
"Involved in the lipid remodeling steps of GPI-anchor maturation"
],
"length": 263,
"sequence": "MVLLLLLLVGEAAASQGDREPVYRDCRTRCEQYNCTGARLWTFRALQPAYMRLTGWTCKDDCSYECMWYTVALYVKEGHKVPQFHGKVSLNAWIWSTVFHTRDTDITEKLDYFCASAVILHSIYLCGVRTLGLKRPAFAQFFAPFLILLFACHVSYLSLGRFDYGYNMAANVAFGLVNLLWWLGWCLRNQAYLPYVWKCEVVVLLLQALALLELLDFPPLLWVFDAHALWHLSTVPVHILFYSFLVDDSHHLLKENPSDVKID",
"proteome": "UP000515159",
"gene": "PGAP3",
"go_terms": [
{
"identifier": "GO:0006506",
"name": "GPI anchor biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "de2a4e0609099ce2987b6e3b13a3ca28f56d70a5",
"counters": {
"domain_architectures": 330,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 330
}
}
}