General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P8LCA0",
        "id": "A0A6P8LCA0_9HYME",
        "source_organism": {
            "taxId": "103933",
            "scientificName": "Bombus bifarius",
            "fullName": "Bombus bifarius"
        },
        "name": "Glutaminyl-peptide cyclotransferase",
        "description": [
            "Acts as a glutaminyl-peptide cyclotransferase. Responsible for the biosynthesis of pyroglutamyl peptides. Might be more efficient in the conversion of tri and tetrapeptides in vitro. Might have a relative preference for substrates containing hydrophobic amino acids in vitro"
        ],
        "length": 366,
        "sequence": "MAALRHSVHWKFATEYDDDLPWFVFFLISMGVLITDSNIITQTSFRNEKYYHTPSSLSRNQIITLSDLSNVDHMNEVLDNICVVRIVGTPEHTRVKDYIKKSMNDLNWTVQSDSFEDQTPTFGPLQFENIVAKLNPNAKRYLALACHYDSKYTRERNFEGATDSAVPCAQMINLAKVMKDYLKSIKDNDISLMLIFFDGEEAFKEWGPKDSIYGARHLADVWHNNHINYTQGENVSELDKIDLLVLLDLIGAPDPTFYNYFSNTEKWYSLLMRTESKLASLKKFESYSYGQPTQTYFQPYSVEAYIEDDHIPFLRRDTPILHLIPYPFPKVWHKQSDNRNNIDLKTTENINKILRVFVASYLHINM",
        "proteome": "UP000515164",
        "gene": "LOC117204427",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d2652df4944c0c7cc1a533e4bec73696ba6ac058",
        "counters": {
            "domain_architectures": 47590,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 47590
        }
    }
}