General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P8KT93",
        "id": "A0A6P8KT93_DROMA",
        "source_organism": {
            "taxId": "7226",
            "scientificName": "Drosophila mauritiana",
            "fullName": "Drosophila mauritiana (Fruit fly)"
        },
        "name": "Juvenile hormone acid O-methyltransferase",
        "description": [
            "O-methyltransferase that transfers a methyl group from S-adenosyl-L-methionine (SAM) to the carboxyl group of juvenile hormone acids to produce active juvenile hormones in the corpora allata, the last step during juvenile hormone biosynthesis. Also able to methylate farnesoate to methyl farnesoate"
        ],
        "length": 297,
        "sequence": "MNQASLYQHANQVQRHDAKLILDEFASTMQWRSDGEDALLDVGSGSGNVLMDFVKPLLPIRGQLVGTDISSQMVHYASKHYQREERTRFQVLDIGCERLPDELSGRFDHVTSFYCLHWVQNLKGALGNIYNLLKPEGGDCLLAFLASNPVYEVYKILRTNEKWSTYMQDVERFISPLHYSSNPGEEFSQLLNDVGFVQHNVEIRNEVFVYEGVRTLKDNVKAICPFLERMPADLHEQFLDDFIDIVISMNLQQGENNEDQKFLSPYKLVVAYARKTPEFVNNVFLEPLHQNLVKGIN",
        "proteome": "UP000515162",
        "gene": "LOC117150689",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c043aa35505ceaded7954fe53dbc11785f5f9abb",
        "counters": {
            "domain_architectures": 25086,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 25086
        }
    }
}