GET /api/protein/UniProt/A0A6P8GLH0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P8GLH0",
        "id": "A0A6P8GLH0_CLUHA",
        "source_organism": {
            "taxId": "7950",
            "scientificName": "Clupea harengus",
            "fullName": "Clupea harengus (Atlantic herring)"
        },
        "name": "Tissue factor",
        "description": [
            "Initiates blood coagulation by forming a complex with circulating factor VII or VIIa. The [TF:VIIa] complex activates factors IX or X by specific limited proteolysis. TF plays a role in normal hemostasis by initiating the cell-surface assembly and propagation of the coagulation protease cascade"
        ],
        "length": 287,
        "sequence": "MYPRGKETIWALGFFTLLLLNTVTGSFPKAQNVSWSSINFKTLLLWSPKPDGYSYTVEFSRLGQNRDRSPHCIQTSETECDLTQQLKNLKHIRETYTAVVQSESARGVPSDIVEPPYTESKKFCPYTDTLIGKPDFNFTVSGRKITINVIDPLTALFNGQNQRMSIRDIFGDDLQYSVMYRRAGSTGKKRQTSATNVIELANVDKGESYCLMVQAAIPSRGLDKQYGELSHTKCTPDNNKGIFDEYGIGAIAGVIFTILAIIIIAIVVMVVCCKRRRKEKSGKEGIV",
        "proteome": "UP000515152",
        "gene": "f3a",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007596",
                "name": "blood coagulation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4e8ed35ce3efeaf359870880ca9e3ba588932285",
        "counters": {
            "domain_architectures": 7828,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "panther": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7828
        }
    }
}