GET /api/protein/UniProt/A0A6P8GIL3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P8GIL3",
"id": "A0A6P8GIL3_CLUHA",
"source_organism": {
"taxId": "7950",
"scientificName": "Clupea harengus",
"fullName": "Clupea harengus (Atlantic herring)"
},
"name": "Sorting nexin-17",
"description": [
"Critical regulator of endosomal recycling of numerous surface proteins, including integrins, signaling receptor and channels. Binds to NPxY sequences in the cytoplasmic tails of target cargos. Associates with retriever and CCC complexes to prevent lysosomal degradation and promote cell surface recycling of numerous cargos such as integrins ITGB1, ITGB5 and their associated alpha subunits. Also required for maintenance of normal cell surface levels of APP and LRP1. Interacts with membranes containing phosphatidylinositol 3-phosphate (PtdIns(3P))"
],
"length": 471,
"sequence": "MHFSIPETEVRSGENGSTYVAYNIHVNGVLHCRVRYSQLLGLHEQIKKEYGNNVVPAFPPKKIFTLTPAEVEQRREQLEKYMQAVRQDPTLGSSEMFNSFLRKAQQETQQIPTEEVQLEVHLSKGQKVRVNILTSDQTEDVLEAVAAKLDLPDELVGYFSLFLVQEGADGGYTFVRKLQEFELPYVSVTSLHSPDFHIVLRKSYWDTAYDNDVMDNRVGLNLLYSQTVSDIERGWILVNKDQHRQLKSLQEKGSKKEFIRLAQTLKYYGYIKFDPCVTDFPEKGCHVIVSAGNNELNFHVKLPSEQMKEGSFKVTRMRCWRVTSSVPVVNGSANPCSSAKCDVKLELAFEYLMSKDRLQWVTITSQQAIMMSICLQAMVDELMVKKSGGSIKKMQKKRLNGALHRSDSNQAVKSPPLLDSPDPNREQVVKLSTKLTSVSLRGISASSSNNDISGNDFHGNFAFEGIGDDDL",
"proteome": "UP000515152",
"gene": "snx17",
"go_terms": [
{
"identifier": "GO:0035091",
"name": "phosphatidylinositol binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007165",
"name": "signal transduction",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6ed846dc64d42cf4321f6ebc923ec708a45308e3",
"counters": {
"domain_architectures": 1926,
"entries": 25,
"isoforms": 0,
"proteomes": 1,
"sets": 6,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"profile": 2,
"cathgene3d": 4,
"cdd": 3,
"ssf": 1,
"pfam": 4,
"panther": 1,
"interpro": 9
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1926
}
}
}