GET /api/protein/UniProt/A0A6P8F559/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P8F559",
        "id": "A0A6P8F559_CLUHA",
        "source_organism": {
            "taxId": "7950",
            "scientificName": "Clupea harengus",
            "fullName": "Clupea harengus (Atlantic herring)"
        },
        "name": "Dual specificity protein phosphatase 22-B isoform X1",
        "description": [
            "Activates the Jnk signaling pathway. Dephosphorylates and deactivates p38 and stress-activated protein kinase/c-Jun N-terminal kinase (SAPK/JNK)"
        ],
        "length": 181,
        "sequence": "MGNGMNKVLPDLYLGNFKDARDREQLAKHNVTHILSIHDTAAPILQEMTYLCIPAADLPTQNLTQHFKESIIFMHESRLKGEGCLVHCLAGVSRSVTLVVAYIMTVTGLSWTEALAAVRVARPGAGPNQGFQRQLQEFDKNEAQQYREWLSREYKENPFDDEVHLRSLLLQASEPVTPQDT",
        "proteome": "UP000515152",
        "gene": "dusp22b",
        "go_terms": [
            {
                "identifier": "GO:0006470",
                "name": "protein dephosphorylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016311",
                "name": "dephosphorylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "15742d355813370d995348f784781e84405a14d7",
        "counters": {
            "domain_architectures": 53529,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "smart": 1,
                "profile": 2,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 53529
        }
    }
}