GET /api/protein/UniProt/A0A6P7Z2V6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P7Z2V6",
"id": "A0A6P7Z2V6_9AMPH",
"source_organism": {
"taxId": "1415580",
"scientificName": "Microcaecilia unicolor",
"fullName": "Microcaecilia unicolor"
},
"name": "Suppressor of cytokine signaling 2",
"description": [
"Substrate-recognition component of a cullin-5-RING E3 ubiquitin-protein ligase complex (ECS complex, also named CRL5 complex), which mediates the ubiquitination and subsequent proteasomal degradation of target proteins, such as EPOR and GHR. Specifically recognizes and binds phosphorylated proteins via its SH2 domain, promoting their ubiquitination. The ECS(SOCS2) complex acts as a key regulator of growth hormone receptor (GHR) levels by mediating ubiquitination and degradation of GHR, following GHR phosphorylation by JAK2. The ECS(SOCS2) also catalyzes ubiquitination and degradation of JAK2-phosphorylated EPOR"
],
"length": 167,
"sequence": "MPRFLQDNRAAQEAKGWYWGSMSVNEAKELLQDAPAGTFLLRDSSHAEYLLTISVKTTAGPTNLRIEYQAGKFRLDSIFCVRAKLKQFESVVRLVEYYVLLSKDRKTESELLPSRAVHFWLTRPLYTSTPSLQHLCRLTVNKYTRKICELPLPTRLKDYLTEYQSHI",
"proteome": "UP000515156",
"gene": "SOCS2",
"go_terms": [
{
"identifier": "GO:0035556",
"name": "intracellular signal transduction",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e16098dee2ddb77b6a79a81058967a7deadb45c6",
"counters": {
"domain_architectures": 6301,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"smart": 3,
"pfam": 2,
"profile": 2,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 6301
}
}
}