General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P7XGW3",
        "id": "A0A6P7XGW3_9AMPH",
        "source_organism": {
            "taxId": "1415580",
            "scientificName": "Microcaecilia unicolor",
            "fullName": "Microcaecilia unicolor"
        },
        "name": "14-3-3 domain-containing protein",
        "description": [
            "Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner"
        ],
        "length": 247,
        "sequence": "MDKTGLIQKAKLAEQAERYDDMASCMKSVTEYGEELSNEERNLLSVAYKNVVGARRSAWRVISSIEQKDEGSEADKKLQMVQEYREKVETELRTICKTVLELLDKFLVPNATNPESKVFYLKMKGDYFRYLAEVASGDDRKQTIEDSQKAYQEAFDISKKEMQPTHPIRLGLALNFSVFFYEILNSPDKACSLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTATDDCETQDTGDN",
        "proteome": "UP000515156",
        "gene": "YWHAQ",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "820720298376d553f2f678d8fdd1a0725bebda38",
        "counters": {
            "domain_architectures": 23404,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "pirsf": 1,
                "panther": 1,
                "prosite": 2,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 23404
        }
    }
}