General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P7PEF9",
        "id": "A0A6P7PEF9_BETSP",
        "source_organism": {
            "taxId": "158456",
            "scientificName": "Betta splendens",
            "fullName": "Betta splendens (Siamese fighting fish)"
        },
        "name": "Biogenesis of lysosome-related organelles complex 1 subunit 3",
        "description": [
            "Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO)"
        ],
        "length": 196,
        "sequence": "MASKYPIVVQGEASETDSDDEVYITSLSAPQIASVGAKVPGEASETDSDGEEEQAPRASALVHDSSQILKRDLPPLIVVRDHPGIQSVVEDGPSPTHRPHGDTLLQQKLQESNSRLCMDVTQTLRHVYGNASKEVRTATAQLNTSQAAIISASHSIRLILDDLKAVSEKIDIITSCQILPDINISTPNYCSGPVQN",
        "proteome": "UP000515150",
        "gene": "bloc1s3",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "45f5674992260c411dc016ee81e9a1c5f0bd22e3",
        "counters": {
            "domain_architectures": 848,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pirsf": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 848
        }
    }
}