General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P7NGV6",
        "id": "A0A6P7NGV6_BETSP",
        "source_organism": {
            "taxId": "158456",
            "scientificName": "Betta splendens",
            "fullName": "Betta splendens (Siamese fighting fish)"
        },
        "name": "Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1",
        "description": [
            "Probable FAD-dependent oxidoreductase; involved in the cellular oxidative stress response. Required for normal sarcomere structure and muscle fiber integrity"
        ],
        "length": 501,
        "sequence": "MACKKEKTFQFVIVGGGIAGVTCVEQLSSQIPSAGVALITAGPHIKAVTNYKQVSRTLEEFNVEERPSSVLEEKFPNLTVIHSAVKSLNTQSHTVETADGRVFGYKKLCICSGGRPKLLTQDNPYVLGIRDTDSAKVFQKQLSNAKRIVIVGNGGIALELVYEVEGCEVIWAVKDKAIGNTFFDAGAAQFLIPSLESNKSERAAPCKRPRYTTEEAAAAGALQTFTADRHLQRQGSGVTEPGSALGPDWHEGIVLRGAEQVSRRVSVEYECEVEKIFTSEELLNSPQQTLRPENGTWPVYIQLSNGQTFGCDFVVSAIGVVPNTEPFLHGNSFAVADDAGLKVDDHMVTSEPDVYAAGDVCTACWELSSLWQQMRLWTQARQMGWYAGRCMAAHVLSETIELDFCFELFSHITKFFNYKVVLLGKFNAQGLGPDHELLVRCTKGQEYVKVVLSGGKMVGAVLIGETDLEETFENLILNQMDLTPYGEELLNPNIDIEDYFD",
        "proteome": "UP000515150",
        "gene": "pyroxd1",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "9297b7097993cbe27d6a4f3f020323e7e2245acb",
        "counters": {
            "domain_architectures": 1056,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "ssf": 1,
                "cathgene3d": 2,
                "panther": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1056
        }
    }
}