GET /api/protein/UniProt/A0A6P7LPA2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P7LPA2",
"id": "A0A6P7LPA2_BETSP",
"source_organism": {
"taxId": "158456",
"scientificName": "Betta splendens",
"fullName": "Betta splendens (Siamese fighting fish)"
},
"name": "Putative E3 ubiquitin-protein ligase UBR7",
"description": [
"E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation"
],
"length": 370,
"sequence": "MSEEQTVSLVDVLEEDEELEEEASAVLAGSDSDHCSYPEGYVKRQALYACNTCTPTGGEPAGVCLACTYICHEGHDLFELYTKRNFRCDCGNRKFKGLQCKLHPDKDEVNNLNKYSQNFFGLYCTCNRPYPDPDDQVEDEMIQCVICEDWLHGRHLGCVVPDSVELQEMICELCMNKNPFLWTYAVHLSVPDEAEQIKEESGADATKQASDVIEPPSAKRIRGETEFKCRLEELLSTGQKRVQSGAVFWPSAWRSKLCSCQTCQARLSECGVSFLLDETDTVSAYERKGRNNEQKHEGNDPLMTALDNLNRVQQLEIIHGYNDMKAELKDFLQRFAAEGKVVTSEDIRQFFDQQHTRKRRQVDSGCLYRT",
"proteome": "UP000515150",
"gene": "ubr7",
"go_terms": [
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0061630",
"name": "ubiquitin protein ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "30fdaa49fa9761e18be20efff28ac8266769df61",
"counters": {
"domain_architectures": 4854,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"profile": 1,
"cdd": 2,
"ssf": 1,
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4854
}
}
}