GET /api/protein/UniProt/A0A6P7LKM7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P7LKM7",
        "id": "A0A6P7LKM7_BETSP",
        "source_organism": {
            "taxId": "158456",
            "scientificName": "Betta splendens",
            "fullName": "Betta splendens (Siamese fighting fish)"
        },
        "name": "Syntaxin-binding protein 6",
        "description": [
            "Forms non-fusogenic complexes with SNAP25 and STX1A and may thereby modulate the formation of functional SNARE complexes and exocytosis"
        ],
        "length": 210,
        "sequence": "MSTKSAINKEVFVPHDEKMLAAVQVKRRTKKKIPFLATGGQGDYYTFICVSVTNKKPLHVSITKVKQFQGSSAFVKRSQWTIDQLRQVNGIDPSKDCPEFDLTFDNAFDQWVASSAGEKCTFIQILHHTCQRYSSVRKPEFVNCQSKLLGGNSILHSAADSVTSAVQKASQALNERGERLGRAEERTADMMNSAEQFAVTAHKLAMKHKC",
        "proteome": "UP000515150",
        "gene": "stxbp6",
        "go_terms": [
            {
                "identifier": "GO:0035542",
                "name": "regulation of SNARE complex assembly",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "374534795d7f835b8cde979145e5184aba7a88d3",
        "counters": {
            "domain_architectures": 1575,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 2,
                "cathgene3d": 2,
                "smart": 1,
                "pfam": 1,
                "profile": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1575
        }
    }
}