GET /api/protein/UniProt/A0A6P7LI88/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P7LI88",
"id": "A0A6P7LI88_BETSP",
"source_organism": {
"taxId": "158456",
"scientificName": "Betta splendens",
"fullName": "Betta splendens (Siamese fighting fish)"
},
"name": "Cytochrome c oxidase copper chaperone",
"description": [
"Copper metallochaperone essential for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. Binds two copper ions and delivers them to the metallochaperone SCO1 which transports the copper ions to the Cu(A) site on the cytochrome c oxidase subunit II (MT-CO2/COX2)"
],
"length": 70,
"sequence": "MLEMSAVCAASAEPPAVTEGSEQKKPLKPCCACPETKKVRDACIIEKGEENCTALIEAHKECMRALGFKI",
"proteome": "UP000515150",
"gene": "LOC114847640",
"go_terms": [
{
"identifier": "GO:0005507",
"name": "copper ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016531",
"name": "copper chaperone activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005758",
"name": "mitochondrial intermembrane space",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1433098304dfcb6ac91510bff5aaf918490d03e2",
"counters": {
"domain_architectures": 3451,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3451
}
}
}